Search results for "Magnetic Field"

showing 10 items of 1488 documents

Influence of mobile phone electromagnetic fields on TEOAEs recordings

2006

Settore MED/31 - Otorinolaringoiatriaelectromagnetic fieldTEOAEMobile phoneSettore MED/32 - Audiologia
researchProduct

Resolving the Fundamentals of Magnetotransport in Metals with Ultrafast Terahertz Spectroscopy

2016

Using terahertz spectroscopy we directly resolved the fundamentals of spin-dependent conductivity in ferromagnetic metals. We quantified the differences in conduction by Fermi-level electrons with opposite spins on the sub-100 fs timescale of electron momentum scattering.

SpinsFerromagnetismCondensed matter physicsScatteringChemistryCondensed Matter::Strongly Correlated ElectronsElectronConductivityThermal conductionTerahertz spectroscopy and technologyMagnetic fieldInternational Conference on Ultrafast Phenomena
researchProduct

Ni61Mössbauer study of the hyperfine magnetic field near the Ni surface

1987

$^{61}\mathrm{Ni}$ M\"ossbauer measurements have been performed at 4.2 K on spherical Ni particles covered with a protective layer of SiO, with average diameter of 500 and 50 \AA{}. The hyperfine magnetic field at $^{61}\mathrm{Ni}$ nuclei for 500-\AA{} particles has been found to be 78.3(4) kOe, compared with the field for Ni foil of 75.0(2) kOe. The small difference is due to the demagnetization and dipolar fields in 500-\AA{} particles. The spectrum of 50-\AA{} particles has a surface component with the corresponding value of the hyperfine magnetic field of 40.3(5.4) kOe. This strongly indicates that, in accordance with recent theoretical studies, there is a decrease of the hyperfine mag…

Materials scienceMössbauer effectField (physics)Condensed matter physicsDemagnetizing fieldchemistry.chemical_elementMagnetic fieldCondensed Matter::Materials ScienceDipoleNickelchemistryMössbauer spectroscopyAtomic physicsHyperfine structurePhysical Review B
researchProduct

(F, G) -summed form of the QED effective action

2021

We conjecture that the proper-time series expansion of the one-loop effective Lagrangian of quantum electrodynamics can be summed in all terms containing the field-strength invariants $\mathcal{F}=\frac{1}{4}{F}_{\ensuremath{\mu}\ensuremath{\nu}}{F}^{\ensuremath{\mu}\ensuremath{\nu}}(x)$, $\mathcal{G}=\frac{1}{4}{\stackrel{\texttildelow{}}{F}}_{\ensuremath{\mu}\ensuremath{\nu}}{F}^{\ensuremath{\mu}\ensuremath{\nu}}(x)$, including those also possessing derivatives of the electromagnetic field strength. This partial resummation is exactly encapsulated in a factor with the same form as the Heisenberg-Euler Lagrangian density, except that now the electric and magnetic fields can depend arbitrar…

PhysicsConjecture010308 nuclear & particles physics01 natural sciencesMagnetic fieldPair productionElectric field0103 physical sciencesProper timeResummation010306 general physicsSeries expansionEffective actionMathematical physicsPhysical Review D
researchProduct

Combined Effects of 50 Hz Electromagnetic Field and SiO2 Nanoparticles on Oxidative Stress in Plant’s Gametic Cells / Zemfrekvences (50 Hz) Elekromag…

2015

Abstract The paper presents the results of combined effects of an extremely low frequency electromagnetic field (50 Hz) (ELF EMF) and SiO2 nanoparticles on fluorescence of plant gametic cells (immature microspores). The data were recorded by a BD FACSJazz® cell sorter after cell irradiation by blue laser (488 nm). A significant difference of fluorescence was observed between gametic cells after 1 hour incubation in suspension of SiO2 nanoparticles and the control gametic cells. It was observed that fluorescence intensity of gametic cell was higher with ELF EMF treatment in comparison to control cells, but it was statistically significant only for cells treated with electromagnetic radiation…

Electromagnetic fieldsilicon dioxide nanoparticlesMultidisciplinaryGeneral interestflow cytometryScience50 hz electromagnetic radiationQmedicine.disease_causeSio2 nanoparticlesBiophysicsmedicineoxidative stressOxidative stressimmature microsporesProceedings of the Latvian Academy of Sciences. Section B, Natural Sciences
researchProduct

Two-dimensional single- and multiple-quantum correlation spectroscopy in zero-field nuclear magnetic resonance.

2020

We present single- and multiple-quantum correlation $J$-spectroscopy detected in zero ($<\!\!1$~$\mu$G) magnetic field using a \Rb vapor-cell magnetometer. At zero field the spectrum of ethanol appears as a mixture of \carbon isotopomers, and correlation spectroscopy is useful in separating the two composite spectra. We also identify and observe the zero-field equivalent of a double-quantum transition in ${}^{13}$C$_2$-acetic acid, and show that such transitions are of use in spectral assignment. Two-dimensional spectroscopy further improves the high resolution attained in zero-field NMR since selection rules on the coherence-transfer pathways allow for the separation of otherwise overlappi…

Nuclear and High Energy PhysicsZero field NMRMagnetometerNuclear Magnetic Resonancephysics.chem-phBiophysicsFOS: Physical sciences010402 general chemistry01 natural sciencesBiochemistryMolecular physicsSpectral line030218 nuclear medicine & medical imagingIsotopomerslaw.invention03 medical and health sciences0302 clinical medicineEngineeringquant-phlawPhysics - Chemical PhysicsJ-Spectroscopy2D NMRSpectroscopyPhysicsChemical Physics (physics.chem-ph)Quantum PhysicsCorrelation spectroscopyZero (complex analysis)Zero-field NMRCondensed Matter PhysicsMultiple-quantum NMR3. Good health0104 chemical sciencesMagnetic fieldZULF NMRPhysical SciencesQuantum Physics (quant-ph)Two-dimensional nuclear magnetic resonance spectroscopy
researchProduct

Plasma diagnostic tools for ECR ion sources : What can we learn from these experiments for the next generation sources

2019

International audience; The order-of-magnitude performance leaps of ECR ion sources over the past decades result from improvements to the magnetic plasma confinement, increases in the microwave heating frequency, and techniques to stabilize the plasma at high densities. Parallel to the technical development of the ion sources themselves, significant effort has been directed into the development of their plasma diagnostic tools. We review the recent results of Electron Cyclotron Resonance Ion Source (ECRIS) plasma diagnostics highlighting a number of selected examples of plasma density, electron energy distribution, and ion confinement time measurements, obtained mostly with the second-gener…

[PHYS.PHYS.PHYS-ACC-PH]Physics [physics]/Physics [physics]/Accelerator Physics [physics.acc-ph]Solenoidmagnetic fieldshiukkaskiihdyttimetplasmafysiikka7. Clean energy01 natural sciencesbremsstrahlungElectron cyclotron resonance010305 fluids & plasmasIonoptical emission spectroscopySuperposition principleion sourcesPhysics::Plasma Physics0103 physical sciencesInstrumentation010302 applied physicsPhysics[PHYS]Physics [physics]plasma confinementplasma properties and parametersplasma diagnosticssyklotronitplasma heatingPlasmaIon sourceComputational physicsMagnetic fieldPlasma diagnostics
researchProduct

Structure of longitudinal chromomagnetic fields in high energy collisions

2014

We compute expectation values of spatial Wilson loops in the forward light cone of high-energy collisions. We consider ensembles of gauge field configurations generated from a classical Gaussian effective action as well as solutions of high-energy renormalization group evolution with fixed and running coupling. The initial fields correspond to a color field condensate exhibiting domain-like structure over distance scales of order the saturation scale. At later times universal scaling emerges at large distances for all ensembles, with a nontrivial critical exponent. Finally, we compare the results for the Wilson loop to the two-point correlator of magnetic fields.

We compute expectation values of spatial Wilson loops in the forward light cone of high-energy collisions. We consider ensembles of gauge field configurations generated from a classical Gaussian effective action as well as solutions of high-energy renormalization group evolution with fixed and running coupling. The initial like structure over distance scales of oder the saturation scale. At later times universal scaling emerges at large distances for all ensembles with a nontrivial critical exponent. Finally we compare the resulats for the Wilson loop to the two-point correlator of magnetic fields. (C) 2014 The Authors. Published by Elsevier BV This is an open access article under the CC BY licenseNuclear and High Energy PhysicsWilson loopLARGE NUCLEINuclear TheoryField (physics)FOS: Physical sciences114 Physical sciences01 natural sciencesColor-glass condensateRENORMALIZATION-GROUPNuclear Theory (nucl-th)GLUON DISTRIBUTION-FUNCTIONSHigh Energy Physics - Phenomenology (hep-ph)Light cone0103 physical sciencesSCATTERINGGauge theory010306 general physicsSMALL-XEffective actionPhysicsCORRELATORSta114010308 nuclear & particles physicsCOLOR GLASS CONDENSATERenormalization groupEVOLUTIONJIMWLK EQUATIONHigh Energy Physics - PhenomenologySATURATIONQuantum electrodynamicsCritical exponentPhysics Letters B
researchProduct

Joule heating and the thermal evolution of old neutron stars

1998

We consider Joule heating caused by dissipation of the magnetic field in the neutron star crust. This mechanism may be efficient in maintaining a relatively high surface temperature in very old neutron stars. Calculations of the thermal evolution show that, at the late evolutionary stage ($t \geq 10$ Myr), the luminosity of the neutron star is approximately equal to the energy released due to the field dissipation and is practically independent of the atmosphere models. At this stage, the surface temperature can be of the order of $3 \times 10^{4} - 10^{5}$K. Joule heating can maintain this high temperature during extremely long time ($\geq 100$ Myr), comparable with the decay time of the m…

PhysicsField (physics)Astrophysics (astro-ph)FOS: Physical sciencesAstronomy and AstrophysicsAstrophysics::Cosmology and Extragalactic AstrophysicsAstrophysicsDissipationAstrophysicsLuminosityMagnetic fieldNeutron starSpace and Planetary ScienceThermalAstrophysics::Solar and Stellar AstrophysicsAstrophysics::Earth and Planetary AstrophysicsMagnetohydrodynamicsJoule heatingAstrophysics::Galaxy Astrophysics
researchProduct

Magnetized boxes for housing polarized spins in homogeneous fields

2010

Abstract We present novel types of permanently magnetized as well as current powered boxes built from soft-ferromagnetic materials. They provide shielded magnetic fields which are homogeneous within a large fraction of the enclosed volume, thus minimizing size, weight, and costs. For the permanently magnetized solutions, homogenization is achieved either by an optimized distribution of the permanent field sources or by jacketing the field with a soft-ferromagnetic cylindrical shell which is magnetized in parallel to the enclosed field. The latter principle may be applied up to fields of about 0.1 T. With fields of about 1 mT, such boxes are being used for shipping spin-polarized 3 He worldw…

PhysicsNuclear and High Energy PhysicsCondensed matter physicsSpinsBiophysicsMechanicsModels TheoreticalCondensed Matter PhysicsBiochemistryHomogenization (chemistry)Magnetic fieldlaw.inventionMagneticsElectromagnetic FieldsHomogeneouslawShielded cableComputer SimulationSpin LabelsJournal of Magnetic Resonance
researchProduct